PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 293aa    MW: 33217.2 Da    PI: 8.2115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15917.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed ll ++++ +G g+Wk+ +++ g+ R++k+c++rw +yl
       KHN15917.1 14 KGPWTPKEDALLTKYIQAHGEGQWKSLPKKAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding491.4e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+  +eEd+l+++ + +lG++ W++Ia +++ gRt++++k++w+++l
       KHN15917.1  67 RGNIAPEEDDLIIRMHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                      566679****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.536961IPR017930Myb domain
SuperFamilySSF466891.14E-2911108IPR009057Homeodomain-like
SMARTSM007175.2E-131363IPR001005SANT/Myb domain
PfamPF002495.3E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-241568IPR009057Homeodomain-like
CDDcd001673.83E-101661No hitNo description
PROSITE profilePS5129426.07262116IPR017930Myb domain
SMARTSM007175.2E-1566114IPR001005SANT/Myb domain
PfamPF002495.2E-1468112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-2669116IPR009057Homeodomain-like
CDDcd001679.67E-1272112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGRAPCCSKV GLHKGPWTPK EDALLTKYIQ AHGEGQWKSL PKKAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI APEEDDLIIR MHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLSKKLKIQG  120
TEDTDTHKML ENPQEEAASD GGNNNKKKKK KKNGGKKNKQ KNKGKENDEP PKTQVYLPKP  180
IRVKAMYLQR TDSNTFTFDS NSASGSTSQE KEESPVTKES NVVSEVGNVG EESDGFGFFS  240
EDHDLVNVSD IECHSYFPTD HGNLQQLYEE YFQLLNMDHG QFELNSFAES LLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1145151KKKKKKK
2147156KKKKKNGGKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0963970.0BT096397.1 Soybean clone JCVI-FLGm-20P11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001238271.10.0MYB transcription factor MYB92
TrEMBLA0A0B2Q7Z70.0A0A0B2Q7Z7_GLYSO; Transcription factor MYB3
TrEMBLQ0PJJ90.0Q0PJJ9_SOYBN; MYB transcription factor MYB92
STRINGGLYMA16G02570.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.13e-66myb domain protein 111
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]